Lineage for d1kp4a_ (1kp4 A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 777954Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 777955Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 778290Family a.133.1.3: Prokaryotic phospholipase A2 [63630] (1 protein)
  6. 778291Protein Prokaryotic phospholipase A2 [63631] (1 species)
  7. 778292Species Streptomyces violaceoruber [TaxId:1935] [63632] (5 PDB entries)
  8. 778295Domain d1kp4a_: 1kp4 A: [77479]
    Calcium-bound form
    complexed with ca

Details for d1kp4a_

PDB Entry: 1kp4 (more details), 1.6 Å

PDB Description: calcium-bound form of prokaryotic phospholipase a2
PDB Compounds: (A:) phospholipase a2

SCOP Domain Sequences for d1kp4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kp4a_ a.133.1.3 (A:) Prokaryotic phospholipase A2 {Streptomyces violaceoruber [TaxId: 1935]}
apadkpqvlasftqtsassqnawlaanrnqsawaayefdwstdlctqapdnpfgfpfnta
carhdfgyrnykaagsfdanksridsafyedmkrvctgytgekntacnstawtyyqavki
fg

SCOP Domain Coordinates for d1kp4a_:

Click to download the PDB-style file with coordinates for d1kp4a_.
(The format of our PDB-style files is described here.)

Timeline for d1kp4a_: