Lineage for d1koya_ (1koy A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014033Fold a.164: C-terminal domain of DFF45/ICAD (DFF-C domain) [81782] (1 superfamily)
    4 helices; folded leaf; right-handed superhelix
  4. 2014034Superfamily a.164.1: C-terminal domain of DFF45/ICAD (DFF-C domain) [81783] (1 family) (S)
  5. 2014035Family a.164.1.1: C-terminal domain of DFF45/ICAD (DFF-C domain) [81784] (1 protein)
  6. 2014036Protein C-terminal domain of DFF45/ICAD (DFF-C domain) [81785] (1 species)
    present only in a long splicing variant of DFF45; essential for chaperone activity
  7. 2014037Species Human (Homo sapiens) [TaxId:9606] [81786] (2 PDB entries)
  8. 2014038Domain d1koya_: 1koy A: [77478]
    CASP5

Details for d1koya_

PDB Entry: 1koy (more details)

PDB Description: NMR structure of DFF-C domain
PDB Compounds: (A:) DNA fragmentation factor alpha subunit

SCOPe Domain Sequences for d1koya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1koya_ a.164.1.1 (A:) C-terminal domain of DFF45/ICAD (DFF-C domain) {Human (Homo sapiens) [TaxId: 9606]}
shiltalrekqapelslssqdlelvtkedpkalavalnwdikktetvqeacerelalrlq
qt

SCOPe Domain Coordinates for d1koya_:

Click to download the PDB-style file with coordinates for d1koya_.
(The format of our PDB-style files is described here.)

Timeline for d1koya_: