Lineage for d1kolb2 (1kol B:161-355)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841006Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (19 proteins)
    N-terminal all-beta domain defines family
  6. 2841294Protein Formaldehyde dehydrogenase [82287] (1 species)
  7. 2841295Species Pseudomonas putida [TaxId:303] [82288] (1 PDB entry)
  8. 2841297Domain d1kolb2: 1kol B:161-355 [77477]
    Other proteins in same PDB: d1kola1, d1kolb1
    complexed with nad, so4, zn

Details for d1kolb2

PDB Entry: 1kol (more details), 1.65 Å

PDB Description: Crystal structure of formaldehyde dehydrogenase
PDB Compounds: (B:) formaldehyde dehydrogenase

SCOPe Domain Sequences for d1kolb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kolb2 c.2.1.1 (B:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]}
irdltclsdilptgyhgavtagvgpgstvyvagagpvglaaaasarllgaavvivgdlnp
arlahakaqgfeiadlsldtplheqiaallgepevdcavdavgfearghghegakheapa
tvlnslmqvtrvagkigipglyvtedpgavdaaakigslsirfglgwakshsfhtgqtpv
mkynralmqaimwdr

SCOPe Domain Coordinates for d1kolb2:

Click to download the PDB-style file with coordinates for d1kolb2.
(The format of our PDB-style files is described here.)

Timeline for d1kolb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kolb1