Lineage for d1kola1 (1kol A:2-160,A:356-397)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 558060Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 558061Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 558147Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 558370Protein Formaldehyde dehydrogenase [82081] (1 species)
  7. 558371Species Pseudomonas putida [TaxId:303] [82082] (1 PDB entry)
  8. 558372Domain d1kola1: 1kol A:2-160,A:356-397 [77474]
    Other proteins in same PDB: d1kola2, d1kolb2

Details for d1kola1

PDB Entry: 1kol (more details), 1.65 Å

PDB Description: Crystal structure of formaldehyde dehydrogenase

SCOP Domain Sequences for d1kola1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kola1 b.35.1.2 (A:2-160,A:356-397) Formaldehyde dehydrogenase {Pseudomonas putida}
gnrgvvylgsgkvevqkidypkmqdprgkkiehgvilkvvstnicgsdqhmvrgrttaqv
glvlgheitgeviekgrdvenlqigdlvsvpfnvacgrcrsckemhtgvcltvnparagg
aygyvdmgdwtggqaeyvlvpyadfnllklpdrdkamekXiniaevvgvqvislddaprg
ygefdagvpkkfvidphktfsa

SCOP Domain Coordinates for d1kola1:

Click to download the PDB-style file with coordinates for d1kola1.
(The format of our PDB-style files is described here.)

Timeline for d1kola1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kola2