Lineage for d1koka_ (1kok A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 283714Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 283715Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) (S)
  5. 283716Family a.93.1.1: CCP-like [48114] (4 proteins)
  6. 283726Protein Cytochrome c peroxidase, CCP [48119] (1 species)
  7. 283727Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (80 PDB entries)
  8. 283733Domain d1koka_: 1kok A: [77473]
    mesopone state
    complexed with hif

Details for d1koka_

PDB Entry: 1kok (more details), 1.7 Å

PDB Description: Crystal Structure of Mesopone Cytochrome c Peroxidase (MpCcP)

SCOP Domain Sequences for d1koka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1koka_ a.93.1.1 (A:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae)}
ttplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkh
dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
gpkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkt
hlknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliq
dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

SCOP Domain Coordinates for d1koka_:

Click to download the PDB-style file with coordinates for d1koka_.
(The format of our PDB-style files is described here.)

Timeline for d1koka_: