Lineage for d1ko6.2 (1ko6 C:,D:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2075403Fold b.119: C-terminal autoproteolytic domain of nucleoporin nup98 [82214] (1 superfamily)
    multisheet protein with a mixture of beta-sandwich and beta-prism features
  4. 2075404Superfamily b.119.1: C-terminal autoproteolytic domain of nucleoporin nup98 [82215] (1 family) (S)
  5. 2075405Family b.119.1.1: C-terminal autoproteolytic domain of nucleoporin nup98 [82216] (1 protein)
  6. 2075406Protein C-terminal autoproteolytic domain of nucleoporin nup98 [82217] (1 species)
    pore-targeting domain
  7. 2075407Species Human (Homo sapiens) [TaxId:9606] [82218] (1 PDB entry)
  8. 2075409Domain d1ko6.2: 1ko6 C:,D: [77472]

Details for d1ko6.2

PDB Entry: 1ko6 (more details), 3 Å

PDB Description: Crystal Structure of C-terminal Autoproteolytic Domain of Nucleoporin Nup98
PDB Compounds: (C:) Nuclear Pore Complex Protein Nup98, (D:) Nuclear Pore Complex Protein Nup98

SCOPe Domain Sequences for d1ko6.2:

Sequence, based on SEQRES records: (download)

>g1ko6.2 b.119.1.1 (C:,D:) C-terminal autoproteolytic domain of nucleoporin nup98 {Human (Homo sapiens) [TaxId: 9606]}
hpagiiltkvgyytipsmddlakitnekgecivsdftigrkgygsiyfegdvnltnlnld
divhirrkevvvylddnqkppvgeglnrkaevtldgvwptdktsrclikspdrladinye
grleavsrkqgaqfkeyrpetgswvfkvshfXkyglqd

Sequence, based on observed residues (ATOM records): (download)

>g1ko6.2 b.119.1.1 (C:,D:) C-terminal autoproteolytic domain of nucleoporin nup98 {Human (Homo sapiens) [TaxId: 9606]}
hpagiiltkvgyytipsmddlakitnecivsdftigrkgygsiyfegdvnltnlnlddiv
hirrkevvvylddnqkppvgeglnrkaevtldgvwptdktsrclikspdrladinyegrl
eavsrkqgaqfkeyrpetgswvfkvshfXkyglqd

SCOPe Domain Coordinates for d1ko6.2:

Click to download the PDB-style file with coordinates for d1ko6.2.
(The format of our PDB-style files is described here.)

Timeline for d1ko6.2: