Lineage for d1knxe1 (1knx E:1-132)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2166502Fold c.98: MurF and HprK N-domain-like [63417] (2 superfamilies)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1234; structural similarity of the MurF and HprK extends beyond the core.
  4. 2166519Superfamily c.98.2: HprK N-terminal domain-like [75138] (2 families) (S)
    probable phosphatase
  5. 2166520Family c.98.2.1: HPr kinase/phoshatase HprK N-terminal domain [75139] (1 protein)
    automatically mapped to Pfam PF02603
  6. 2166521Protein HPr kinase/phoshatase HprK N-terminal domain [75140] (2 species)
  7. 2166522Species Mycoplasma pneumoniae [TaxId:2104] [82321] (1 PDB entry)
  8. 2166527Domain d1knxe1: 1knx E:1-132 [77467]
    Other proteins in same PDB: d1knxa2, d1knxb2, d1knxc2, d1knxd2, d1knxe2, d1knxf2

Details for d1knxe1

PDB Entry: 1knx (more details), 2.5 Å

PDB Description: HPr kinase/phosphatase from Mycoplasma pneumoniae
PDB Compounds: (E:) Probable HPr(Ser) kinase/phosphatase

SCOPe Domain Sequences for d1knxe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1knxe1 c.98.2.1 (E:1-132) HPr kinase/phoshatase HprK N-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]}
mkkllvkelieqfqdcvnlidghtntsnvirvpglkrvvfemlglfssqigsvailgkre
fgflsqktlveqqqilhnllklnppaiiltksftdptvllqvnqtyqvpilktdffstel
sftvetyineqf

SCOPe Domain Coordinates for d1knxe1:

Click to download the PDB-style file with coordinates for d1knxe1.
(The format of our PDB-style files is described here.)

Timeline for d1knxe1: