Lineage for d1knxd2 (1knx D:133-307)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143071Fold c.91: PEP carboxykinase-like [53794] (1 superfamily)
    contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one side
  4. 2143072Superfamily c.91.1: PEP carboxykinase-like [53795] (3 families) (S)
  5. 2143156Family c.91.1.2: HPr kinase HprK C-terminal domain [64186] (1 protein)
    automatically mapped to Pfam PF07475
  6. 2143157Protein HPr kinase HprK C-terminal domain [64187] (3 species)
  7. 2143178Species Mycoplasma pneumoniae [TaxId:2104] [82554] (1 PDB entry)
  8. 2143182Domain d1knxd2: 1knx D:133-307 [77466]
    Other proteins in same PDB: d1knxa1, d1knxb1, d1knxc1, d1knxd1, d1knxe1, d1knxf1

Details for d1knxd2

PDB Entry: 1knx (more details), 2.5 Å

PDB Description: HPr kinase/phosphatase from Mycoplasma pneumoniae
PDB Compounds: (D:) Probable HPr(Ser) kinase/phosphatase

SCOPe Domain Sequences for d1knxd2:

Sequence, based on SEQRES records: (download)

>d1knxd2 c.91.1.2 (D:133-307) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]}
atvaqihgvllevfgvgvlltgrsgigksecaldlinknhlfvgddaieiyrlgnrlfgr
aqevakkfmeirglgiinverfyglqitkqrteiqlmvnllslekqttvtferlgtelkk
qrllgvdlsfyeipispgrktseiiesavidfklkhsgynsaldfienqkailkr

Sequence, based on observed residues (ATOM records): (download)

>d1knxd2 c.91.1.2 (D:133-307) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]}
atvaqihgvllevfgvgvlltgrsgigksecaldlinknhlfvgddaieiyrlgnrlfgr
aqevakkfmeirglgiinverfyglqitkqrteiqlmvnllsletvtferlgtelkkqrl
lgvdlsfyeipispgrktseiiesavidfklkhsgynsaldfienqkailkr

SCOPe Domain Coordinates for d1knxd2:

Click to download the PDB-style file with coordinates for d1knxd2.
(The format of our PDB-style files is described here.)

Timeline for d1knxd2: