Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.98: MurF and HprK N-domain-like [63417] (2 superfamilies) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1234; structural similarity of the MurF and HprK extends beyond the core. |
Superfamily c.98.2: HprK N-terminal domain-like [75138] (2 families) probable phosphatase |
Family c.98.2.1: HPr kinase/phoshatase HprK N-terminal domain [75139] (1 protein) automatically mapped to Pfam PF02603 |
Protein HPr kinase/phoshatase HprK N-terminal domain [75140] (2 species) |
Species Mycoplasma pneumoniae [TaxId:2104] [82321] (1 PDB entry) |
Domain d1knxa1: 1knx A:1-132 [77459] Other proteins in same PDB: d1knxa2, d1knxb2, d1knxc2, d1knxd2, d1knxe2, d1knxf2 |
PDB Entry: 1knx (more details), 2.5 Å
SCOPe Domain Sequences for d1knxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1knxa1 c.98.2.1 (A:1-132) HPr kinase/phoshatase HprK N-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} mkkllvkelieqfqdcvnlidghtntsnvirvpglkrvvfemlglfssqigsvailgkre fgflsqktlveqqqilhnllklnppaiiltksftdptvllqvnqtyqvpilktdffstel sftvetyineqf
Timeline for d1knxa1: