SCOP 1.69: Domain d1kn1b_: 1kn1 B:

Lineage for d1kn1b_ (1kn1 B:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (6 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore

6. Protein Allophycocyanin beta subunit [88957] (3 species)

7. Species Red algae (Porphyra yezoensis) [TaxId:2788] [88960] (1 PDB entry)

8. Domain d1kn1b_: 1kn1 B: [77456]
   Other proteins in same PDB: d1kn1a_

Details for d1kn1b_

PDB Entry: 1kn1, 2.2 Å

PDB Description: crystal structure of allophycocyanin

SCOP Domain Sequences for d1kn1b_:

Sequence; same for both SEQRES and ATOM records:

>d1kn1b_ a.1.1.3 (B:) Allophycocyanin beta subunit {Red algae (Porphyra yezoensis)}
mqdaitsvinssdvqgkyldssaieklkgyfqtgelrvraattiaanaaniikeavaksl
lysditrpggnmyttrryaacirdldyylryatyamlagdpsildervlnglketynslg
vpigatiqaiqamkevtsglvgpdagkemglyfdyicsgls

Timeline for d1kn1b_:

• d1kn1b_ first appeared in SCOP 1.63
  
• d1kn1b_ appears in SCOP 1.67
  
• d1kn1b_ appears in SCOP 1.71
  
• d1kn1b_ appears in the current release, SCOPe 2.08