Lineage for d1kn1a_ (1kn1 A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1473061Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1473062Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1475382Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 1475383Protein Allophycocyanin alpha subunit [88953] (3 species)
  7. 1475391Species Red algae (Porphyra yezoensis) [TaxId:2788] [88956] (1 PDB entry)
  8. 1475392Domain d1kn1a_: 1kn1 A: [77455]
    Other proteins in same PDB: d1kn1b_
    complexed with cyc

Details for d1kn1a_

PDB Entry: 1kn1 (more details), 2.2 Å

PDB Description: crystal structure of allophycocyanin
PDB Compounds: (A:) allophycocyanin

SCOPe Domain Sequences for d1kn1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kn1a_ a.1.1.3 (A:) Allophycocyanin alpha subunit {Red algae (Porphyra yezoensis) [TaxId: 2788]}
sivtksivnadaearylspgeldriksfvlsgarrvriaqtltenrerivkqagdqlfqk
rpdvvspggnaygeemtatclrdldyylrlvtygivsgdvtpieeiglvgvremykslgt
pisavaegvkcmksvassllsgedsaeagfyfdyvvgamq

SCOPe Domain Coordinates for d1kn1a_:

Click to download the PDB-style file with coordinates for d1kn1a_.
(The format of our PDB-style files is described here.)

Timeline for d1kn1a_: