SCOPe 2.06: Domain d1kmta1: 1kmt A:67-202

Lineage for d1kmta1 (1kmt A:67-202)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.8: RhoGDI-like [81288] (3 proteins)

6. Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49242] (12 PDB entries)

8. Domain d1kmta1: 1kmt A:67-202 [77442]
   Other proteins in same PDB: d1kmta2, d1kmtb2
   mutant

Details for d1kmta1

PDB Entry: 1kmt, 1.3 Å

PDB Description: crystal structure of rhogdi glu(154,155)ala mutant

PDB Compounds: (A:) rho GDP-dissociation inhibitor 1

SCOPe Domain Sequences for d1kmta1:

Sequence; same for both SEQRES and ATOM records:

>d1kmta1 b.1.18.8 (A:67-202) Rho GDP-dissociation inhibitor 1, RhoGDI {Human (Homo sapiens) [TaxId: 9606]}
vpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsgm
kyiqhtyrkgvkidktdymvgsygpraaayefltpveeapkgmlargsysiksrftdddk
tdhlswewnltikkdw

Timeline for d1kmta1:

• d1kmta1 first appeared in SCOP 1.63, called d1kmta_
  
• d1kmta1 was called d1kmta_ in SCOPe 2.05
  
• d1kmta1 appears in SCOPe 2.07
  
• d1kmta1 appears in the current release, SCOPe 2.08