SCOP 1.75: Domain d1kmga_: 1kmg A:

Lineage for d1kmga_ (1kmg A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (11 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49333] (27 PDB entries)

8. Domain d1kmga_: 1kmg A: [77441]
   monomeric copper-free mutant

Details for d1kmga_

PDB Entry: 1kmg

PDB Description: the solution structure of monomeric copper-free superoxide dismutase

PDB Compounds: (A:) superoxide dismutase

SCOP Domain Sequences for d1kmga_:

Sequence; same for both SEQRES and ATOM records:

>d1kmga_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]}
atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvheeedntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
ekaddlgkggneqstktgnagsrlacgvigiaq

Timeline for d1kmga_:

• d1kmga_ first appeared in SCOP 1.63
  
• d1kmga_ appears in SCOP 1.73
  
• d1kmga_ appears in SCOPe 2.01
  
• d1kmga_ appears in the current release, SCOPe 2.08