SCOPe 2.05: Domain d1klxa_: 1klx A:

Lineage for d1klxa_ (1klx A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.18: HCP-like [81901] (1 family)

5. Family a.118.18.1: HCP-like [81902] (2 proteins)
   Helicobacter Cysteine-rich Protein
   this is a repeat family; one repeat unit is 1ouv A:184-220 found in domain

6. Protein Cysteine rich protein B (HcpB) [81903] (1 species)
   a penicillin-binding protein

7. Species Helicobacter pylori [TaxId:210] [81904] (1 PDB entry)

8. Domain d1klxa_: 1klx A: [77440]
   structural genomics

Details for d1klxa_

PDB Entry: 1klx, 1.95 Å

PDB Description: helicobacter pylori cysteine rich protein b (hcpb)

PDB Compounds: (A:) Cysteine Rich Protein B

SCOPe Domain Sequences for d1klxa_:

Sequence; same for both SEQRES and ATOM records:

>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]}
gggtvkkdlkkaiqyyvkacelnemfgclslvsnsqinkqklfqylskacelnsgngcrf
lgdfyengkyvkkdlrkaaqyyskacglndqdgclilgykqyagkgvvknekqavktfek
acrlgsedacgil

Timeline for d1klxa_:

• d1klxa_ first appeared in SCOP 1.63
  
• d1klxa_ appears in SCOPe 2.04
  
• d1klxa_ appears in SCOPe 2.06
  
• d1klxa_ appears in the current release, SCOPe 2.08