Lineage for d1klxa_ (1klx A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 284903Fold a.118: alpha-alpha superhelix [48370] (17 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 285295Superfamily a.118.18: Cysteine rich protein B (HcpB) [81901] (1 family) (S)
  5. 285296Family a.118.18.1: Cysteine rich protein B (HcpB) [81902] (1 protein)
    this is a repeat family; one repeat unit is 1ouv A:184-220 found in domain
  6. 285297Protein Cysteine rich protein B (HcpB) [81903] (1 species)
    a penicillin-binding protein
  7. 285298Species Helicobacter pylori [TaxId:210] [81904] (1 PDB entry)
  8. 285299Domain d1klxa_: 1klx A: [77440]
    structural genomics

Details for d1klxa_

PDB Entry: 1klx (more details), 1.95 Å

PDB Description: helicobacter pylori cysteine rich protein b (hcpb)

SCOP Domain Sequences for d1klxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori}
gggtvkkdlkkaiqyyvkacelnemfgclslvsnsqinkqklfqylskacelnsgngcrf
lgdfyengkyvkkdlrkaaqyyskacglndqdgclilgykqyagkgvvknekqavktfek
acrlgsedacgil

SCOP Domain Coordinates for d1klxa_:

Click to download the PDB-style file with coordinates for d1klxa_.
(The format of our PDB-style files is described here.)

Timeline for d1klxa_: