Lineage for d1klxa_ (1klx A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2727465Superfamily a.118.18: HCP-like [81901] (1 family) (S)
  5. 2727466Family a.118.18.1: HCP-like [81902] (2 proteins)
    Helicobacter Cysteine-rich Protein
    this is a repeat family; one repeat unit is 1ouv A:184-220 found in domain
  6. 2727467Protein Cysteine rich protein B (HcpB) [81903] (1 species)
    a penicillin-binding protein
  7. 2727468Species Helicobacter pylori [TaxId:210] [81904] (1 PDB entry)
  8. 2727469Domain d1klxa_: 1klx A: [77440]
    structural genomics

Details for d1klxa_

PDB Entry: 1klx (more details), 1.95 Å

PDB Description: helicobacter pylori cysteine rich protein b (hcpb)
PDB Compounds: (A:) Cysteine Rich Protein B

SCOPe Domain Sequences for d1klxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]}
gggtvkkdlkkaiqyyvkacelnemfgclslvsnsqinkqklfqylskacelnsgngcrf
lgdfyengkyvkkdlrkaaqyyskacglndqdgclilgykqyagkgvvknekqavktfek
acrlgsedacgil

SCOPe Domain Coordinates for d1klxa_:

Click to download the PDB-style file with coordinates for d1klxa_.
(The format of our PDB-style files is described here.)

Timeline for d1klxa_: