Lineage for d1klka_ (1klk A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 249080Fold c.71: Dihydrofolate reductases [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 249081Superfamily c.71.1: Dihydrofolate reductases [53597] (1 family) (S)
  5. 249082Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins)
  6. 249168Protein Dihydrofolate reductases, eukaryotic type [53605] (4 species)
  7. 249178Species Fungus (Pneumocystis carinii) [TaxId:4754] [53608] (11 PDB entries)
  8. 249187Domain d1klka_: 1klk A: [77439]
    complexed with ndp, pmd

Details for d1klka_

PDB Entry: 1klk (more details), 2.3 Å

PDB Description: crystal structure of pneumocystis carinii dihydrofolate reductase ternary complex with pt653 and nadph

SCOP Domain Sequences for d1klka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1klka_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Fungus (Pneumocystis carinii)}
qksltlivalttsygigrsnslpwklkkeisyfkrvtsfvptfdsfesmnvvlmgrktwe
siplqfrplkgrinvvitrnesldlgngihsaksldhalellyrtygsessvqinrifvi
ggaqlykaamdhpkldrimatiiykdihcdvffplkfrdkewssvwkkekhsdleswvgt
kvphgkinedgfdyefemwtrdl

SCOP Domain Coordinates for d1klka_:

Click to download the PDB-style file with coordinates for d1klka_.
(The format of our PDB-style files is described here.)

Timeline for d1klka_: