Class b: All beta proteins [48724] (144 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (46 proteins) |
Protein Coagulation factor VIIa [50550] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [50551] (10 PDB entries) |
Domain d1kljh_: 1klj H: [77437] Other proteins in same PDB: d1kljl_ |
PDB Entry: 1klj (more details), 2.44 Å
SCOP Domain Sequences for d1kljh_:
Sequence, based on SEQRES records: (download)
>d1kljh_ b.47.1.2 (H:) Coagulation factor VIIa {Human (Homo sapiens)} ivggkvcpkgecpwqvlllvngaqlcggtlintiwvvsaahcfdkiknwrnliavlgehd lsehdgdeqsrrvaqviipstyvpgttnhdiallrlhqpvvltdhvvplclpertfsert lafvrfslvsgwgqlldrgatalelmvlnvprlmtqdclqqsrkvgdspniteymfcagy sdgskdsckgdsggphathyrgtwyltgivswgqgcatvghfgvytrvsqyiewlqklmr seprpgvllrapfp
>d1kljh_ b.47.1.2 (H:) Coagulation factor VIIa {Human (Homo sapiens)} ivggkvcpkgecpwqvlllvngaqlcggtlintiwvvsaahcfdkiknwrnliavlgehd lsehdgdeqsrrvaqviipstyvpgttnhdiallrlhqpvvltdhvvplclpertfsert lafvrfslvsgwgqlldrgatalelmvlnvprlmtqdclqqsrniteymfcagysdgskd sckgdsggphathyrgtwyltgivswgqgcatvghfgvytrvsqyiewlqklmrseprpg vllrapfp
Timeline for d1kljh_: