Lineage for d1klil_ (1kli L:)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 521093Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 521739Superfamily g.3.11: EGF/Laminin [57196] (6 families) (S)
  5. 521740Family g.3.11.1: EGF-type module [57197] (21 proteins)
  6. 521749Protein Coagulation factor VIIa [57201] (1 species)
  7. 521750Species Human (Homo sapiens) [TaxId:9606] [57202] (15 PDB entries)
  8. 521751Domain d1klil_: 1kli L: [77436]
    Other proteins in same PDB: d1klih_
    C-terminal domain

Details for d1klil_

PDB Entry: 1kli (more details), 1.69 Å

PDB Description: Cofactor-and substrate-assisted activation of factor VIIa

SCOP Domain Sequences for d1klil_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1klil_ g.3.11.1 (L:) Coagulation factor VIIa {Human (Homo sapiens)}
hkddqlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipilek
r

SCOP Domain Coordinates for d1klil_:

Click to download the PDB-style file with coordinates for d1klil_.
(The format of our PDB-style files is described here.)

Timeline for d1klil_:

521751
d1klil_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1klih_