![]() | Class g: Small proteins [56992] (75 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.11: EGF/Laminin [57196] (6 families) ![]() |
![]() | Family g.3.11.1: EGF-type module [57197] (21 proteins) |
![]() | Protein Coagulation factor VIIa [57201] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57202] (15 PDB entries) |
![]() | Domain d1klil_: 1kli L: [77436] Other proteins in same PDB: d1klih_ C-terminal domain |
PDB Entry: 1kli (more details), 1.69 Å
SCOP Domain Sequences for d1klil_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1klil_ g.3.11.1 (L:) Coagulation factor VIIa {Human (Homo sapiens)} hkddqlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipilek r
Timeline for d1klil_: