SCOP 1.63: Domain d1kk9a_: 1kk9 A:

Lineage for d1kk9a_ (1kk9 A:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.115: YrdC/RibB [55820] (1 superfamily)
   core: alpha-beta(2)-alpha-beta-alpha(2)-beta(2)-alpha-beta-alpha-beta; 3 layers; mixed twisted sheet of 7 strands; order 7126354; strands 7 and 1 are parallel to each other

4. Superfamily d.115.1: YrdC/RibB [55821] (2 families)

5. Family d.115.1.1: YrdC-like [55822] (3 proteins)
   contains two additional strands in the C-terminal extension

6. Protein Hypothetical protein YciO [75529] (1 species)

7. Species Escherichia coli [TaxId:562] [75530] (2 PDB entries)

8. Domain d1kk9a_: 1kk9 A: [77432]
   complexed with mse, so4

Details for d1kk9a_

PDB Entry: 1kk9, 2.1 Å

PDB Description: crystal structure of e. coli ycio

SCOP Domain Sequences for d1kk9a_:

Sequence; same for both SEQRES and ATOM records:

>d1kk9a_ d.115.1.1 (A:) Hypothetical protein YciO {Escherichia coli}
msqffyihpdnpqqrlinqaveivrkggvivyptdsgyalgckiedknamericrirqlp
dghnftlmcrdlselstysfvdnvafrlmknntpgnytfilkgtkevprrllqekrktig
mrvpsnpiaqallealgepmlstslmlpgseftesdpeeikdrlekqvdliihggylgqk
pttvidltddtpvvvregvgdvkpfl

Timeline for d1kk9a_:

• d1kk9a_ is new in SCOP 1.63
  
• d1kk9a_ appears in SCOP 1.65
  
• d1kk9a_ appears in the current release, SCOPe 2.08