Lineage for d1kk8c_ (1kk8 C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323235Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2323236Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2323718Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2324241Protein Myosin Regulatory Chain [47527] (2 species)
  7. 2324242Species Bay scallop (Aequipecten irradians) [TaxId:31199] [47528] (15 PDB entries)
    Uniprot P07291
  8. 2324247Domain d1kk8c_: 1kk8 C: [77431]
    Other proteins in same PDB: d1kk8a1, d1kk8a2, d1kk8b_
    complexed with adp, bef, ca, gol, mg

Details for d1kk8c_

PDB Entry: 1kk8 (more details), 2.3 Å

PDB Description: scallop myosin (s1-adp-befx) in the actin-detached conformation
PDB Compounds: (C:) Myosin Essential Light Chain,Striated adductor muscle

SCOPe Domain Sequences for d1kk8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kk8c_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}
pklsqdeiddlkdvfelfdfwdgrdgavdafklgdvcrclginprnedvfavggthkmge
kslpfeeflpayeglmdceqgtfadymeafktfdregqgfisgaelrhvltalgerlsde
dvdeiikltdlqedlegnvkyedfvkkvmagpyp

SCOPe Domain Coordinates for d1kk8c_:

Click to download the PDB-style file with coordinates for d1kk8c_.
(The format of our PDB-style files is described here.)

Timeline for d1kk8c_: