Lineage for d1kk8b_ (1kk8 B:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 213166Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 213167Superfamily a.39.1: EF-hand [47473] (9 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 213324Family a.39.1.5: Calmodulin-like [47502] (17 proteins)
    Duplication: made with two pairs of EF-hands
  6. 213436Protein Myosin Essential Chain [47524] (2 species)
  7. 213437Species Bay scallop (Aequipecten irradians) [TaxId:31199] [47525] (10 PDB entries)
  8. 213439Domain d1kk8b_: 1kk8 B: [77430]
    Other proteins in same PDB: d1kk8a1, d1kk8a2, d1kk8c_
    complexed with adp, bef, ca, gol, mg; mutant

Details for d1kk8b_

PDB Entry: 1kk8 (more details), 2.3 Å

PDB Description: scallop myosin (s1-adp-befx) in the actin-detached conformation
PDB Compounds: (B:)

SCOP Domain Sequences for d1kk8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kk8b_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians)}
pqkqiqemkeafsmidvdrdgfvskedikaiseqlgrapddkeltamlkeapgplnftmf
lsifsdklsgtdseetirnafamfdeqetkklnieyikdllenmgdnfnkdemrmtfkea
pveggkfdyvkftamikgs

SCOP Domain Coordinates for d1kk8b_:

Click to download the PDB-style file with coordinates for d1kk8b_.
(The format of our PDB-style files is described here.)

Timeline for d1kk8b_: