![]() | Class a: All alpha proteins [46456] (171 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (9 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.5: Calmodulin-like [47502] (17 proteins) Duplication: made with two pairs of EF-hands |
![]() | Protein Myosin Essential Chain [47524] (2 species) |
![]() | Species Bay scallop (Aequipecten irradians) [TaxId:31199] [47525] (10 PDB entries) |
![]() | Domain d1kk8b_: 1kk8 B: [77430] Other proteins in same PDB: d1kk8a1, d1kk8a2, d1kk8c_ complexed with adp, bef, ca, gol, mg; mutant |
PDB Entry: 1kk8 (more details), 2.3 Å
SCOP Domain Sequences for d1kk8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kk8b_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians)} pqkqiqemkeafsmidvdrdgfvskedikaiseqlgrapddkeltamlkeapgplnftmf lsifsdklsgtdseetirnafamfdeqetkklnieyikdllenmgdnfnkdemrmtfkea pveggkfdyvkftamikgs
Timeline for d1kk8b_: