Lineage for d1kk8a1 (1kk8 A:29-76)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1784069Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (2 families) (S)
  5. 1784070Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)
  6. 1784071Protein Myosin S1 fragment, N-terminal domain [50086] (4 species)
  7. 1784072Species Bay scallop (Aequipecten irradians) [TaxId:31199] [50088] (11 PDB entries)
    Uniprot P24733 3-836 ! Uniprot P24733 6-837
  8. 1784073Domain d1kk8a1: 1kk8 A:29-76 [77428]
    Other proteins in same PDB: d1kk8a2, d1kk8b_, d1kk8c_
    complexed with adp, bef, ca, gol, mg

Details for d1kk8a1

PDB Entry: 1kk8 (more details), 2.3 Å

PDB Description: scallop myosin (s1-adp-befx) in the actin-detached conformation
PDB Compounds: (A:) myosin heavy chain, striated muscle

SCOPe Domain Sequences for d1kk8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kk8a1 b.34.3.1 (A:29-76) Myosin S1 fragment, N-terminal domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}
dgkkncwvpdekegfasaeiqsskgdeitvkivadsstrtvkkddiqs

SCOPe Domain Coordinates for d1kk8a1:

Click to download the PDB-style file with coordinates for d1kk8a1.
(The format of our PDB-style files is described here.)

Timeline for d1kk8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kk8a2