SCOP 1.63: Domain d1kk8a1: 1kk8 A:29-76

Lineage for d1kk8a1 (1kk8 A:29-76)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.34: SH3-like barrel [50036] (12 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family)

5. Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)

6. Protein Myosin S1 fragment, N-terminal domain [50086] (3 species)

7. Species Bay scallop (Aequipecten irradians) [TaxId:31199] [50088] (8 PDB entries)

8. Domain d1kk8a1: 1kk8 A:29-76 [77428]
   Other proteins in same PDB: d1kk8a2, d1kk8b_, d1kk8c_
   complexed with adp, bef, ca, gol, mg; mutant

Details for d1kk8a1

PDB Entry: 1kk8, 2.3 Å

PDB Description: scallop myosin (s1-adp-befx) in the actin-detached conformation

SCOP Domain Sequences for d1kk8a1:

Sequence; same for both SEQRES and ATOM records:

>d1kk8a1 b.34.3.1 (A:29-76) Myosin S1 fragment, N-terminal domain {Bay scallop (Aequipecten irradians)}
dgkkncwvpdekegfasaeiqsskgdeitvkivadsstrtvkkddiqs

Timeline for d1kk8a1:

• d1kk8a1 is new in SCOP 1.63
  
• d1kk8a1 appears in SCOP 1.65
  
• d1kk8a1 appears in the current release, SCOPe 2.08