Lineage for d1kk7a1 (1kk7 A:29-76)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 665027Fold b.34: SH3-like barrel [50036] (18 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 665407Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family) (S)
  5. 665408Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)
  6. 665409Protein Myosin S1 fragment, N-terminal domain [50086] (4 species)
  7. 665410Species Bay scallop (Aequipecten irradians) [TaxId:31199] [50088] (11 PDB entries)
  8. 665417Domain d1kk7a1: 1kk7 A:29-76 [77424]
    Other proteins in same PDB: d1kk7a2, d1kk7y_, d1kk7z_
    complexed with ca, mg, so4

Details for d1kk7a1

PDB Entry: 1kk7 (more details), 3.2 Å

PDB Description: scallop myosin in the near rigor conformation
PDB Compounds: (A:) myosin heavy chain, striated muscle

SCOP Domain Sequences for d1kk7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kk7a1 b.34.3.1 (A:29-76) Myosin S1 fragment, N-terminal domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}
dgkkncwvpdekegfasaeiqsskgdeitvkivadsstrtvkkddiqs

SCOP Domain Coordinates for d1kk7a1:

Click to download the PDB-style file with coordinates for d1kk7a1.
(The format of our PDB-style files is described here.)

Timeline for d1kk7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kk7a2