Lineage for d1kjva1 (1kjv A:182-276)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 654537Protein Class I MHC, alpha-3 domain [88604] (3 species)
  7. 654844Species Rat (Rattus norvegicus), RT1-AA [TaxId:10116] [88607] (3 PDB entries)
  8. 654845Domain d1kjva1: 1kjv A:182-276 [77421]
    Other proteins in same PDB: d1kjva2, d1kjvb_
    complexed with so4

Details for d1kjva1

PDB Entry: 1kjv (more details), 1.48 Å

PDB Description: tap-b-associated rat mhc class i molecule
PDB Compounds: (A:) Mature alpha chain of major histocompatibility complex class I antigen (HEAVY CHAIN)

SCOP Domain Sequences for d1kjva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kjva1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Rat (Rattus norvegicus), RT1-AA [TaxId: 10116]}
sdppkahvtlhprpegdvtlrcwalgfypaditltwqlngedltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrveheglpkplsqrwep

SCOP Domain Coordinates for d1kjva1:

Click to download the PDB-style file with coordinates for d1kjva1.
(The format of our PDB-style files is described here.)

Timeline for d1kjva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kjva2
View in 3D
Domains from other chains:
(mouse over for more information)
d1kjvb_