Lineage for d1kjpa_ (1kjp A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 415443Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 415444Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) (S)
  5. 415450Family d.92.1.2: Thermolysin-like [55490] (4 proteins)
    includes alpha-helical C-terminal domain characteristic for the family
  6. 415461Protein Thermolysin [63414] (1 species)
  7. 415462Species Bacillus thermoproteolyticus [TaxId:1427] [55494] (51 PDB entries)
  8. 415464Domain d1kjpa_: 1kjp A: [77420]
    complexed with ca, glu, phq, zn

Details for d1kjpa_

PDB Entry: 1kjp (more details), 1.6 Å

PDB Description: Thermolysin complexed with Z-L-Glutamic acid (benzyloxycarbonyl-L-Glutamic acid)

SCOP Domain Sequences for d1kjpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kjpa_ d.92.1.2 (A:) Thermolysin {Bacillus thermoproteolyticus}
itgtstvgvgrgvlgdqkninttystyyylqdntrgngiftydakyrttlpgslwadadn
qffasydapavdahyyagvtydyyknvhnrlsydgnnaairssvhysqgynnafwngsqm
vygdgdgqtfiplsggidvvahelthavtdytagliyqnesgaineaisdifgtlvefya
nknpdweigedvytpgisgdslrsmsdpakygdpdhyskrytgtqdnggvhinsgiinka
aylisqggthygvsvvgigrdklgkifyraltqyltptsnfsqlraaavqsatdlygsts
qevasvkqafdavgvk

SCOP Domain Coordinates for d1kjpa_:

Click to download the PDB-style file with coordinates for d1kjpa_.
(The format of our PDB-style files is described here.)

Timeline for d1kjpa_: