Lineage for d1kjmb_ (1kjm B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 931882Protein beta2-microglobulin [88600] (5 species)
  7. 932596Species Norway rat (Rattus norvegicus) [TaxId:10116] [88601] (6 PDB entries)
  8. 932601Domain d1kjmb_: 1kjm B: [77418]
    Other proteins in same PDB: d1kjma1, d1kjma2
    complexed with so4

Details for d1kjmb_

PDB Entry: 1kjm (more details), 2.35 Å

PDB Description: tap-a-associated rat mhc class i molecule
PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d1kjmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kjmb_ b.1.1.2 (B:) beta2-microglobulin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
iqktpqiqvysrhppengkpnflncyvsqfhppqieiellkngkkipniemsdlsfskdw
sfyilahteftptetdvyacrvkhvtlkepktvtwdrdm

SCOPe Domain Coordinates for d1kjmb_:

Click to download the PDB-style file with coordinates for d1kjmb_.
(The format of our PDB-style files is described here.)

Timeline for d1kjmb_: