Lineage for d1kjmb_ (1kjm B:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 548300Protein beta2-microglobulin [88600] (4 species)
  7. 548545Species Rat (Rattus norvegicus) [TaxId:10116] [88601] (6 PDB entries)
  8. 548552Domain d1kjmb_: 1kjm B: [77418]
    Other proteins in same PDB: d1kjma1, d1kjma2
    complexed with so4

Details for d1kjmb_

PDB Entry: 1kjm (more details), 2.35 Å

PDB Description: TAP-A-associated rat MHC class I molecule

SCOP Domain Sequences for d1kjmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kjmb_ b.1.1.2 (B:) beta2-microglobulin {Rat (Rattus norvegicus)}
iqktpqiqvysrhppengkpnflncyvsqfhppqieiellkngkkipniemsdlsfskdw
sfyilahteftptetdvyacrvkhvtlkepktvtwdrdm

SCOP Domain Coordinates for d1kjmb_:

Click to download the PDB-style file with coordinates for d1kjmb_.
(The format of our PDB-style files is described here.)

Timeline for d1kjmb_: