Lineage for d1kjma2 (1kjm A:1-181)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1197982Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1197983Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1197984Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1198031Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
  7. 1198425Species Rat (Rattus norvegicus), RT1-AA [TaxId:10116] [54486] (3 PDB entries)
  8. 1198427Domain d1kjma2: 1kjm A:1-181 [77417]
    Other proteins in same PDB: d1kjma1, d1kjmb_
    complexed with so4

Details for d1kjma2

PDB Entry: 1kjm (more details), 2.35 Å

PDB Description: tap-a-associated rat mhc class i molecule
PDB Compounds: (A:) RT1 class I histocompatibility antigen, AA alpha chain, heavy chain

SCOPe Domain Sequences for d1kjma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kjma2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Rat (Rattus norvegicus), RT1-AA [TaxId: 10116]}
gshslryfytavsrpglgeprfiavgyvddtefvrfdsdaenprmeprarwmeregpeyw
eqqtriakeweqiyrvdlrtlrgyynqseggshtiqemygcdvgsdgsllrgyrqdaydg
rdyialnedlktwtaadfaaqitrnkweraryaerlraylegtcvewlsrylelgketll
r

SCOPe Domain Coordinates for d1kjma2:

Click to download the PDB-style file with coordinates for d1kjma2.
(The format of our PDB-style files is described here.)

Timeline for d1kjma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kjma1
View in 3D
Domains from other chains:
(mouse over for more information)
d1kjmb_