Lineage for d1kjma1 (1kjm A:182-277)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 932656Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 933026Species Rat (Rattus norvegicus), RT1-AA [TaxId:10116] [88607] (3 PDB entries)
  8. 933028Domain d1kjma1: 1kjm A:182-277 [77416]
    Other proteins in same PDB: d1kjma2, d1kjmb_
    complexed with so4

Details for d1kjma1

PDB Entry: 1kjm (more details), 2.35 Å

PDB Description: tap-a-associated rat mhc class i molecule
PDB Compounds: (A:) RT1 class I histocompatibility antigen, AA alpha chain, heavy chain

SCOPe Domain Sequences for d1kjma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kjma1 b.1.1.2 (A:182-277) Class I MHC, alpha-3 domain {Rat (Rattus norvegicus), RT1-AA [TaxId: 10116]}
sdppeahvtlhprpegdvtlrcwalgfypaditltwqlngedltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrveheglpkplsqrwepl

SCOPe Domain Coordinates for d1kjma1:

Click to download the PDB-style file with coordinates for d1kjma1.
(The format of our PDB-style files is described here.)

Timeline for d1kjma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kjma2
View in 3D
Domains from other chains:
(mouse over for more information)
d1kjmb_