SCOP 1.63: Domain d1kjma1: 1kjm A:182-277

Lineage for d1kjma1 (1kjm A:182-277)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)

7. Species Rat (Rattus norvegicus), RT1-AA [TaxId:10116] [48964] (3 PDB entries)

8. Domain d1kjma1: 1kjm A:182-277 [77416]
   Other proteins in same PDB: d1kjma2
   complexed with so4

Details for d1kjma1

PDB Entry: 1kjm, 2.35 Å

PDB Description: tap-a-associated rat mhc class i molecule

SCOP Domain Sequences for d1kjma1:

Sequence; same for both SEQRES and ATOM records:

>d1kjma1 b.1.1.2 (A:182-277) Class I MHC, beta2-microglobulin and alpha-3 domain {Rat (Rattus norvegicus), RT1-AA}
sdppeahvtlhprpegdvtlrcwalgfypaditltwqlngedltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrveheglpkplsqrwepl

Timeline for d1kjma1:

• d1kjma1 is new in SCOP 1.63
  
• d1kjma1 appears in SCOP 1.65
  
• d1kjma1 appears in the current release, SCOPe 2.08