Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Class I MHC, alpha-3 domain [88604] (4 species) |
Species Norway rat (Rattus norvegicus), RT1-AA [TaxId:10116] [88607] (3 PDB entries) |
Domain d1kjma1: 1kjm A:182-276 [77416] Other proteins in same PDB: d1kjma2, d1kjma3, d1kjmb_ complexed with so4 |
PDB Entry: 1kjm (more details), 2.35 Å
SCOPe Domain Sequences for d1kjma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kjma1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Norway rat (Rattus norvegicus), RT1-AA [TaxId: 10116]} sdppeahvtlhprpegdvtlrcwalgfypaditltwqlngedltqdmelvetrpagdgtf qkwasvvvplgkeqnytcrveheglpkplsqrwep
Timeline for d1kjma1: