SCOP 1.75: Domain d1khzb_: 1khz B:

Lineage for d1khzb_ (1khz B:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (7 families)

5. Family d.113.1.1: MutT-like [55812] (16 proteins)

6. Protein ADP-ribose pyrophosphatase [64365] (3 species)

7. Species Escherichia coli [TaxId:562] [64366] (5 PDB entries)

8. Domain d1khzb_: 1khz B: [77415]
   complexed with adv, cl, mg

Details for d1khzb_

PDB Entry: 1khz, 2.04 Å

PDB Description: structure of the adpr-ase in complex with ampcpr and mg

PDB Compounds: (B:) ADP-ribose pyrophosphatase

SCOP Domain Sequences for d1khzb_:

Sequence; same for both SEQRES and ATOM records:

>d1khzb_ d.113.1.1 (B:) ADP-ribose pyrophosphatase {Escherichia coli [TaxId: 562]}
pvtfgkndveiiaretlyrgffsldlyrfrhrlfngqmshevrreiferghaavllpfdp
vrdevvlieqiriaaydtsetpwllemvagmieegesvedvarreaieeaglivkrtkpv
lsflaspggtserssimvgevdattasgihgladenedirvhvvsreqayqwveegkidn
aasvialqwlqlhhqalknewa

Timeline for d1khzb_:

• d1khzb_ first appeared in SCOP 1.63
  
• d1khzb_ appears in SCOP 1.73
  
• d1khzb_ appears in SCOPe 2.01
  
• d1khzb_ appears in the current release, SCOPe 2.08