![]() | Class a: All alpha proteins [46456] (179 folds) |
![]() | Fold a.174: Double Clp-N motif [81922] (1 superfamily) multihelical; array |
![]() | Superfamily a.174.1: Double Clp-N motif [81923] (1 family) ![]() duplication: contains two structural repeats of 4-helical motif |
![]() | Family a.174.1.1: Double Clp-N motif [81924] (2 proteins) |
![]() | Protein Heat shock protein F84.1 (ClpB) N-terminal domain [81927] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [81928] (1 PDB entry) |
![]() | Domain d1khyd_: 1khy D: [77413] complexed with mse |
PDB Entry: 1khy (more details), 1.95 Å
SCOP Domain Sequences for d1khyd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1khyd_ a.174.1.1 (D:) Heat shock protein F84.1 (ClpB) N-terminal domain {Escherichia coli} drltnkfqlaladaqslalghdnqfieplhlmsallnqeggsvsplltsaginagqlrtd inqalnrlpqvegtggdvqpsqdlvrvlnlcdklaqkrgdnfisselfvlaalesrgtla dilkaagattanitqaieqm
Timeline for d1khyd_: