Lineage for d1khyd_ (1khy D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735867Fold a.174: Double Clp-N motif [81922] (1 superfamily)
    multihelical; array
  4. 2735868Superfamily a.174.1: Double Clp-N motif [81923] (2 families) (S)
    duplication: contains two structural repeats of 4-helical motif
  5. 2735869Family a.174.1.1: Double Clp-N motif [81924] (3 proteins)
  6. 2735870Protein N-terminal domain of ClpB (heat shock protein F84.1) [81927] (2 species)
  7. 2735871Species Escherichia coli [TaxId:562] [81928] (1 PDB entry)
  8. 2735875Domain d1khyd_: 1khy D: [77413]

Details for d1khyd_

PDB Entry: 1khy (more details), 1.95 Å

PDB Description: the crystal structure of clpb n terminal domain, implication to the peptide binding function of clpb
PDB Compounds: (D:) clpb protein

SCOPe Domain Sequences for d1khyd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1khyd_ a.174.1.1 (D:) N-terminal domain of ClpB (heat shock protein F84.1) {Escherichia coli [TaxId: 562]}
drltnkfqlaladaqslalghdnqfieplhlmsallnqeggsvsplltsaginagqlrtd
inqalnrlpqvegtggdvqpsqdlvrvlnlcdklaqkrgdnfisselfvlaalesrgtla
dilkaagattanitqaieqm

SCOPe Domain Coordinates for d1khyd_:

Click to download the PDB-style file with coordinates for d1khyd_.
(The format of our PDB-style files is described here.)

Timeline for d1khyd_: