SCOPe 2.07: Domain d1khyc_: 1khy C:

Lineage for d1khyc_ (1khy C:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.174: Double Clp-N motif [81922] (1 superfamily)
   multihelical; array

4. Superfamily a.174.1: Double Clp-N motif [81923] (2 families)
   duplication: contains two structural repeats of 4-helical motif

5. Family a.174.1.1: Double Clp-N motif [81924] (3 proteins)

6. Protein N-terminal domain of ClpB (heat shock protein F84.1) [81927] (2 species)

7. Species Escherichia coli [TaxId:562] [81928] (1 PDB entry)

8. Domain d1khyc_: 1khy C: [77412]

Details for d1khyc_

PDB Entry: 1khy, 1.95 Å

PDB Description: the crystal structure of clpb n terminal domain, implication to the peptide binding function of clpb

PDB Compounds: (C:) clpb protein

SCOPe Domain Sequences for d1khyc_:

Sequence, based on SEQRES records:

>d1khyc_ a.174.1.1 (C:) N-terminal domain of ClpB (heat shock protein F84.1) {Escherichia coli [TaxId: 562]}
drltnkfqlaladaqslalghdnqfieplhlmsallnqeggsvsplltsaginagqlrtd
inqalnrlpqvegtggdvqpsqdlvrvlnlcdklaqkrgdnfisselfvlaalesrgtla
dilkaagattanitqaieqm

Sequence, based on observed residues (ATOM records):

>d1khyc_ a.174.1.1 (C:) N-terminal domain of ClpB (heat shock protein F84.1) {Escherichia coli [TaxId: 562]}
drltnkfqlaladaqslalghdnqfieplhlmsallnqeggsvsplltsaginagqlrtd
inqalnrlpqvdvqpsqdlvrvlnlcdklaqkrgdnfisselfvlaalesrgtladilka
agattanitqaieqm

Timeline for d1khyc_:

• d1khyc_ first appeared in SCOP 1.63
  
• d1khyc_ appears in SCOPe 2.06
  
• d1khyc_ appears in the current release, SCOPe 2.08