![]() | Class a: All alpha proteins [46456] (202 folds) |
![]() | Fold a.174: Double Clp-N motif [81922] (1 superfamily) multihelical; array |
![]() | Superfamily a.174.1: Double Clp-N motif [81923] (1 family) ![]() duplication: contains two structural repeats of 4-helical motif |
![]() | Family a.174.1.1: Double Clp-N motif [81924] (2 proteins) |
![]() | Protein N-terminal domain of ClpB (heat shock protein F84.1) [81927] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [81928] (1 PDB entry) |
![]() | Domain d1khyc_: 1khy C: [77412] |
PDB Entry: 1khy (more details), 1.95 Å
SCOP Domain Sequences for d1khyc_:
Sequence, based on SEQRES records: (download)
>d1khyc_ a.174.1.1 (C:) N-terminal domain of ClpB (heat shock protein F84.1) {Escherichia coli} drltnkfqlaladaqslalghdnqfieplhlmsallnqeggsvsplltsaginagqlrtd inqalnrlpqvegtggdvqpsqdlvrvlnlcdklaqkrgdnfisselfvlaalesrgtla dilkaagattanitqaieqm
>d1khyc_ a.174.1.1 (C:) N-terminal domain of ClpB (heat shock protein F84.1) {Escherichia coli} drltnkfqlaladaqslalghdnqfieplhlmsallnqeggsvsplltsaginagqlrtd inqalnrlpqvdvqpsqdlvrvlnlcdklaqkrgdnfisselfvlaalesrgtladilka agattanitqaieqm
Timeline for d1khyc_: