Lineage for d1khyc_ (1khy C:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 218863Fold a.174: Double Clp-N motif [81922] (1 superfamily)
    multihelical; array
  4. 218864Superfamily a.174.1: Double Clp-N motif [81923] (1 family) (S)
    duplication: contains two structural repeats of 4-helical motif
  5. 218865Family a.174.1.1: Double Clp-N motif [81924] (2 proteins)
  6. 218866Protein Heat shock protein F84.1 (ClpB) N-terminal domain [81927] (1 species)
  7. 218867Species Escherichia coli [TaxId:562] [81928] (1 PDB entry)
  8. 218870Domain d1khyc_: 1khy C: [77412]

Details for d1khyc_

PDB Entry: 1khy (more details), 1.95 Å

PDB Description: the crystal structure of clpb n terminal domain, implication to the peptide binding function of clpb

SCOP Domain Sequences for d1khyc_:

Sequence, based on SEQRES records: (download)

>d1khyc_ a.174.1.1 (C:) Heat shock protein F84.1 (ClpB) N-terminal domain {Escherichia coli}
drltnkfqlaladaqslalghdnqfieplhlmsallnqeggsvsplltsaginagqlrtd
inqalnrlpqvegtggdvqpsqdlvrvlnlcdklaqkrgdnfisselfvlaalesrgtla
dilkaagattanitqaieqm

Sequence, based on observed residues (ATOM records): (download)

>d1khyc_ a.174.1.1 (C:) Heat shock protein F84.1 (ClpB) N-terminal domain {Escherichia coli}
drltnkfqlaladaqslalghdnqfieplhlmsallnqeggsvsplltsaginagqlrtd
inqalnrlpqvdvqpsqdlvrvlnlcdklaqkrgdnfisselfvlaalesrgtladilka
agattanitqaieqm

SCOP Domain Coordinates for d1khyc_:

Click to download the PDB-style file with coordinates for d1khyc_.
(The format of our PDB-style files is described here.)

Timeline for d1khyc_: