Lineage for d1khyb_ (1khy B:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 286987Fold a.174: Double Clp-N motif [81922] (1 superfamily)
    multihelical; array
  4. 286988Superfamily a.174.1: Double Clp-N motif [81923] (1 family) (S)
    duplication: contains two structural repeats of 4-helical motif
  5. 286989Family a.174.1.1: Double Clp-N motif [81924] (2 proteins)
  6. 286990Protein Heat shock protein F84.1 (ClpB) N-terminal domain [81927] (1 species)
  7. 286991Species Escherichia coli [TaxId:562] [81928] (1 PDB entry)
  8. 286993Domain d1khyb_: 1khy B: [77411]

Details for d1khyb_

PDB Entry: 1khy (more details), 1.95 Å

PDB Description: the crystal structure of clpb n terminal domain, implication to the peptide binding function of clpb

SCOP Domain Sequences for d1khyb_:

Sequence, based on SEQRES records: (download)

>d1khyb_ a.174.1.1 (B:) Heat shock protein F84.1 (ClpB) N-terminal domain {Escherichia coli}
ldrltnkfqlaladaqslalghdnqfieplhlmsallnqeggsvsplltsaginagqlrt
dinqalnrlpqvegtggdvqpsqdlvrvlnlcdklaqkrgdnfisselfvlaalesrgtl
adilkaagattanitqaieq

Sequence, based on observed residues (ATOM records): (download)

>d1khyb_ a.174.1.1 (B:) Heat shock protein F84.1 (ClpB) N-terminal domain {Escherichia coli}
ldrltnkfqlaladaqslalghdnqfieplhlmsallnqeggsvsplltsaginagqlrt
dinqalnrlpqvqpsqdlvrvlnlcdklaqkrgdnfisselfvlaalesrgtladilkaa
gattanitqaieq

SCOP Domain Coordinates for d1khyb_:

Click to download the PDB-style file with coordinates for d1khyb_.
(The format of our PDB-style files is described here.)

Timeline for d1khyb_: