SCOP 1.65: Domain d1khyb_: 1khy B:

Lineage for d1khyb_ (1khy B:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.174: Double Clp-N motif [81922] (1 superfamily)
   multihelical; array

4. Superfamily a.174.1: Double Clp-N motif [81923] (1 family)
   duplication: contains two structural repeats of 4-helical motif

5. Family a.174.1.1: Double Clp-N motif [81924] (2 proteins)

6. Protein Heat shock protein F84.1 (ClpB) N-terminal domain [81927] (1 species)

7. Species Escherichia coli [TaxId:562] [81928] (1 PDB entry)

8. Domain d1khyb_: 1khy B: [77411]

Details for d1khyb_

PDB Entry: 1khy, 1.95 Å

PDB Description: the crystal structure of clpb n terminal domain, implication to the peptide binding function of clpb

SCOP Domain Sequences for d1khyb_:

Sequence, based on SEQRES records:

>d1khyb_ a.174.1.1 (B:) Heat shock protein F84.1 (ClpB) N-terminal domain {Escherichia coli}
ldrltnkfqlaladaqslalghdnqfieplhlmsallnqeggsvsplltsaginagqlrt
dinqalnrlpqvegtggdvqpsqdlvrvlnlcdklaqkrgdnfisselfvlaalesrgtl
adilkaagattanitqaieq

Sequence, based on observed residues (ATOM records):

>d1khyb_ a.174.1.1 (B:) Heat shock protein F84.1 (ClpB) N-terminal domain {Escherichia coli}
ldrltnkfqlaladaqslalghdnqfieplhlmsallnqeggsvsplltsaginagqlrt
dinqalnrlpqvqpsqdlvrvlnlcdklaqkrgdnfisselfvlaalesrgtladilkaa
gattanitqaieq

Timeline for d1khyb_:

• d1khyb_ first appeared in SCOP 1.63
  
• d1khyb_ appears in SCOP 1.67
  
• d1khyb_ appears in the current release, SCOPe 2.08