Class a: All alpha proteins [46456] (290 folds) |
Fold a.174: Double Clp-N motif [81922] (1 superfamily) multihelical; array |
Superfamily a.174.1: Double Clp-N motif [81923] (2 families) duplication: contains two structural repeats of 4-helical motif |
Family a.174.1.1: Double Clp-N motif [81924] (3 proteins) |
Protein N-terminal domain of ClpB (heat shock protein F84.1) [81927] (2 species) |
Species Escherichia coli [TaxId:562] [81928] (1 PDB entry) |
Domain d1khya_: 1khy A: [77410] |
PDB Entry: 1khy (more details), 1.95 Å
SCOPe Domain Sequences for d1khya_:
Sequence, based on SEQRES records: (download)
>d1khya_ a.174.1.1 (A:) N-terminal domain of ClpB (heat shock protein F84.1) {Escherichia coli [TaxId: 562]} drltnkfqlaladaqslalghdnqfieplhlmsallnqeggsvsplltsaginagqlrtd inqalnrlpqvegtggdvqpsqdlvrvlnlcdklaqkrgdnfisselfvlaalesrgtla dilkaagattanitqaieq
>d1khya_ a.174.1.1 (A:) N-terminal domain of ClpB (heat shock protein F84.1) {Escherichia coli [TaxId: 562]} drltnkfqlaladaqslalghdnqfieplhlmsallnqeggsvsplltsaginagqlrtd inqalnrlpqvqpsqdlvrvlnlcdklaqkrgdnfisselfvlaalesrgtladilkaag attanitqaieq
Timeline for d1khya_: