Lineage for d1khia2 (1khi A:103-173)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1123681Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1124635Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1124965Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
    barrel, closed; n=5, S=8
  6. 1124969Protein C-terminal domain of eIF5a homologue (Hex1) [82105] (1 species)
  7. 1124970Species Fungus (Neurospora crassa) [TaxId:5141] [82106] (1 PDB entry)
  8. 1124971Domain d1khia2: 1khi A:103-173 [77409]
    Other proteins in same PDB: d1khia1

Details for d1khia2

PDB Entry: 1khi (more details), 1.78 Å

PDB Description: crystal structure of hex1
PDB Compounds: (A:) Hex1

SCOPe Domain Sequences for d1khia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1khia2 b.40.4.5 (A:103-173) C-terminal domain of eIF5a homologue (Hex1) {Fungus (Neurospora crassa) [TaxId: 5141]}
fkqyrvldmqdgsivamtetgdvkqnlpvidqsslwnrlqkafesgrgsvrvlvvsdhgr
emavdmkvvhg

SCOPe Domain Coordinates for d1khia2:

Click to download the PDB-style file with coordinates for d1khia2.
(The format of our PDB-style files is described here.)

Timeline for d1khia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1khia1