Lineage for d1khia1 (1khi A:27-102)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2393545Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) (S)
    many known members contain KOW motif
  5. 2393686Family b.34.5.2: eIF5a N-terminal domain-like [50110] (4 proteins)
  6. 2393705Protein Woronin body major protein (Hex1) [82070] (2 species)
  7. 2393706Species Fungus (Neurospora crassa) [TaxId:5141] [82071] (1 PDB entry)
  8. 2393707Domain d1khia1: 1khi A:27-102 [77408]
    Other proteins in same PDB: d1khia2

Details for d1khia1

PDB Entry: 1khi (more details), 1.78 Å

PDB Description: crystal structure of hex1
PDB Compounds: (A:) Hex1

SCOPe Domain Sequences for d1khia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1khia1 b.34.5.2 (A:27-102) Woronin body major protein (Hex1) {Fungus (Neurospora crassa) [TaxId: 5141]}
gsasqtvtipchhirlgdililqgrpcqviristsaatgqhrylgvdlftkqlheessfv
snpapsvvvqtmlgpv

SCOPe Domain Coordinates for d1khia1:

Click to download the PDB-style file with coordinates for d1khia1.
(The format of our PDB-style files is described here.)

Timeline for d1khia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1khia2