![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (13 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.5: Translation proteins SH3-like domain [50104] (4 families) ![]() many known members contain KOW motif |
![]() | Family b.34.5.2: eIF5a N-terminal domain-like [50110] (2 proteins) |
![]() | Protein Woronin body major protein (Hex1) [82070] (1 species) |
![]() | Species Filamentous fungi (Neurospora crassa) [TaxId:5141] [82071] (1 PDB entry) |
![]() | Domain d1khia1: 1khi A:27-102 [77408] Other proteins in same PDB: d1khia2 |
PDB Entry: 1khi (more details), 1.78 Å
SCOP Domain Sequences for d1khia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1khia1 b.34.5.2 (A:27-102) Woronin body major protein (Hex1) {Filamentous fungi (Neurospora crassa)} gsasqtvtipchhirlgdililqgrpcqviristsaatgqhrylgvdlftkqlheessfv snpapsvvvqtmlgpv
Timeline for d1khia1: