Lineage for d1khia1 (1khi A:27-102)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 295568Fold b.34: SH3-like barrel [50036] (13 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 295918Superfamily b.34.5: Translation proteins SH3-like domain [50104] (4 families) (S)
    many known members contain KOW motif
  5. 295948Family b.34.5.2: eIF5a N-terminal domain-like [50110] (2 proteins)
  6. 295959Protein Woronin body major protein (Hex1) [82070] (1 species)
  7. 295960Species Filamentous fungi (Neurospora crassa) [TaxId:5141] [82071] (1 PDB entry)
  8. 295961Domain d1khia1: 1khi A:27-102 [77408]
    Other proteins in same PDB: d1khia2

Details for d1khia1

PDB Entry: 1khi (more details), 1.78 Å

PDB Description: crystal structure of hex1

SCOP Domain Sequences for d1khia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1khia1 b.34.5.2 (A:27-102) Woronin body major protein (Hex1) {Filamentous fungi (Neurospora crassa)}
gsasqtvtipchhirlgdililqgrpcqviristsaatgqhrylgvdlftkqlheessfv
snpapsvvvqtmlgpv

SCOP Domain Coordinates for d1khia1:

Click to download the PDB-style file with coordinates for d1khia1.
(The format of our PDB-style files is described here.)

Timeline for d1khia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1khia2