SCOPe 2.08: Domain d1khia1: 1khi A:27-102

Lineage for d1khia1 (1khi A:27-102)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families)
   many known members contain KOW motif

5. Family b.34.5.2: eIF5a N-terminal domain-like [50110] (4 proteins)

6. Protein Woronin body major protein (Hex1) [82070] (2 species)

7. Species Fungus (Neurospora crassa) [TaxId:5141] [82071] (1 PDB entry)

8. Domain d1khia1: 1khi A:27-102 [77408]
   Other proteins in same PDB: d1khia2

Details for d1khia1

PDB Entry: 1khi, 1.78 Å

PDB Description: crystal structure of hex1

PDB Compounds: (A:) Hex1

SCOPe Domain Sequences for d1khia1:

Sequence; same for both SEQRES and ATOM records:

>d1khia1 b.34.5.2 (A:27-102) Woronin body major protein (Hex1) {Fungus (Neurospora crassa) [TaxId: 5141]}
gsasqtvtipchhirlgdililqgrpcqviristsaatgqhrylgvdlftkqlheessfv
snpapsvvvqtmlgpv

Timeline for d1khia1:

• d1khia1 first appeared in SCOP 1.63
  
• d1khia1 appears in SCOPe 2.07