Lineage for d1khdd1 (1khd D:12-80)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2327502Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies)
    4 helices; bundle, left-handed twist; right-handed superhelix
  4. 2327513Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families) (S)
    automatically mapped to Pfam PF02885
  5. 2327514Family a.46.2.1: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47649] (3 proteins)
  6. 2327515Protein Anthranilate phosphoribosyltransferase (TrpD) [81774] (3 species)
  7. 2327516Species Pectobacterium carotovorum [TaxId:554] [81776] (2 PDB entries)
  8. 2327520Domain d1khdd1: 1khd D:12-80 [77406]
    Other proteins in same PDB: d1khda2, d1khdb2, d1khdc2, d1khdd2

Details for d1khdd1

PDB Entry: 1khd (more details), 1.86 Å

PDB Description: crystal structure analysis of the anthranilate phosphoribosyltransferase from erwinia carotovora at 1.9 resolution (current name, pectobacterium carotovorum)
PDB Compounds: (D:) Anthranilate phosphoribosyltransferase

SCOPe Domain Sequences for d1khdd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1khdd1 a.46.2.1 (D:12-80) Anthranilate phosphoribosyltransferase (TrpD) {Pectobacterium carotovorum [TaxId: 554]}
thqpileklfksqsmtqeeshqlfaaivrgeledsqlaaalismkmrgerpeeiagaasa
lladaqpfp

SCOPe Domain Coordinates for d1khdd1:

Click to download the PDB-style file with coordinates for d1khdd1.
(The format of our PDB-style files is described here.)

Timeline for d1khdd1: