Lineage for d1khdc2 (1khd C:81-345)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2106674Fold c.27: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52417] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 2106675Superfamily c.27.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52418] (2 families) (S)
    automatically mapped to Pfam PF00591
  5. 2106676Family c.27.1.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52419] (4 protein domains)
  6. 2106677Protein Anthranilate phosphoribosyltransferase (TrpD) [82364] (3 species)
  7. 2106678Species Pectobacterium carotovorum [TaxId:554] [82366] (2 PDB entries)
  8. 2106681Domain d1khdc2: 1khd C:81-345 [77405]
    Other proteins in same PDB: d1khda1, d1khdb1, d1khdc1, d1khdd1

Details for d1khdc2

PDB Entry: 1khd (more details), 1.86 Å

PDB Description: crystal structure analysis of the anthranilate phosphoribosyltransferase from erwinia carotovora at 1.9 resolution (current name, pectobacterium carotovorum)
PDB Compounds: (C:) Anthranilate phosphoribosyltransferase

SCOPe Domain Sequences for d1khdc2:

Sequence, based on SEQRES records: (download)

>d1khdc2 c.27.1.1 (C:81-345) Anthranilate phosphoribosyltransferase (TrpD) {Pectobacterium carotovorum [TaxId: 554]}
rpdydfadivgtggdgtnsinistasafvaascgakvakhgnrsvcqplagscdllqafg
irldmsaedsrqalddlnvcflfapqyhtgfrhampvrqqlktrtifnvlgplinparpp
kaligvyspelvlpiaqalkvlgyknaavvhgggmdevaihtptqvaelnngeiesyqls
pqdfglqsyslnalqggtpeenrdilarllqgkgdaaharqvaanvalllklfgqdnlrh
naqlaletirsgtafervtalaarg

Sequence, based on observed residues (ATOM records): (download)

>d1khdc2 c.27.1.1 (C:81-345) Anthranilate phosphoribosyltransferase (TrpD) {Pectobacterium carotovorum [TaxId: 554]}
rpdydfadivgtgsinistasafvaascgakvakhgnscdllqafgirldmsaedsrqal
ddlnvcflfapqyhtgfrhampvrqqlktrtifnvlgplinparppkaligvyspelvlp
iaqalkvlgyknaavvhgggmdevaihtptqvaelnngeiesyqlspqdfglqsyslnal
qggtpeenrdilarllqgkgdaaharqvaanvalllklfgqdnlrhnaqlaletirsgta
fervtalaarg

SCOPe Domain Coordinates for d1khdc2:

Click to download the PDB-style file with coordinates for d1khdc2.
(The format of our PDB-style files is described here.)

Timeline for d1khdc2: