SCOPe 2.08: Domain d1kgza1: 1kgz A:12-80

Lineage for d1kgza1 (1kgz A:12-80)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies)
   4 helices; bundle, left-handed twist; right-handed superhelix

4. Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families)
   automatically mapped to Pfam PF02885

5. Family a.46.2.1: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47649] (3 proteins)

6. Protein Anthranilate phosphoribosyltransferase (TrpD) [81774] (3 species)

7. Species Pectobacterium carotovorum [TaxId:554] [81776] (2 PDB entries)

8. Domain d1kgza1: 1kgz A:12-80 [77396]
   Other proteins in same PDB: d1kgza2, d1kgzb2
   complexed with hg, mn, prp

Details for d1kgza1

PDB Entry: 1kgz, 2.4 Å

PDB Description: crystal structure analysis of the anthranilate phosphoribosyltransferase from erwinia carotovora (current name, pectobacterium carotovorum)

PDB Compounds: (A:) Anthranilate phosphoribosyltransferase

SCOPe Domain Sequences for d1kgza1:

Sequence; same for both SEQRES and ATOM records:

>d1kgza1 a.46.2.1 (A:12-80) Anthranilate phosphoribosyltransferase (TrpD) {Pectobacterium carotovorum [TaxId: 554]}
thqpileklfksqsmtqeeshqlfaaivrgeledsqlaaalismkmrgerpeeiagaasa
lladaqpfp

Timeline for d1kgza1:

• d1kgza1 first appeared in SCOP 1.63
  
• d1kgza1 appears in SCOPe 2.07