Lineage for d1kgza1 (1kgz A:12-80)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714352Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies)
    4 helices; bundle, left-handed twist; right-handed superhelix
  4. 2714363Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families) (S)
    automatically mapped to Pfam PF02885
  5. 2714364Family a.46.2.1: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47649] (3 proteins)
  6. 2714365Protein Anthranilate phosphoribosyltransferase (TrpD) [81774] (3 species)
  7. 2714366Species Pectobacterium carotovorum [TaxId:554] [81776] (2 PDB entries)
  8. 2714371Domain d1kgza1: 1kgz A:12-80 [77396]
    Other proteins in same PDB: d1kgza2, d1kgzb2
    complexed with hg, mn, prp

Details for d1kgza1

PDB Entry: 1kgz (more details), 2.4 Å

PDB Description: crystal structure analysis of the anthranilate phosphoribosyltransferase from erwinia carotovora (current name, pectobacterium carotovorum)
PDB Compounds: (A:) Anthranilate phosphoribosyltransferase

SCOPe Domain Sequences for d1kgza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kgza1 a.46.2.1 (A:12-80) Anthranilate phosphoribosyltransferase (TrpD) {Pectobacterium carotovorum [TaxId: 554]}
thqpileklfksqsmtqeeshqlfaaivrgeledsqlaaalismkmrgerpeeiagaasa
lladaqpfp

SCOPe Domain Coordinates for d1kgza1:

Click to download the PDB-style file with coordinates for d1kgza1.
(The format of our PDB-style files is described here.)

Timeline for d1kgza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kgza2