Lineage for d1kgjb_ (1kgj B:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 790366Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 790527Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (1 family) (S)
  5. 790528Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (1 protein)
  6. 790529Protein Transthyretin (synonym: prealbumin) [49474] (4 species)
    sandwich; 8 strands in 2 sheets
  7. 790741Species Rat (Rattus norvegicus) [TaxId:10116] [49476] (4 PDB entries)
  8. 790747Domain d1kgjb_: 1kgj B: [77393]

Details for d1kgjb_

PDB Entry: 1kgj (more details), 2.3 Å

PDB Description: Rat transthyretin (also called prealbumin) complex with 3',5'-dibromoflavone (EMD21388)
PDB Compounds: (B:) Transthyretin

SCOP Domain Sequences for d1kgjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kgjb_ b.3.4.1 (B:) Transthyretin (synonym: prealbumin) {Rat (Rattus norvegicus) [TaxId: 10116]}
eskcplmvkvldavrgspavdvavkvfkktadgswepfasgktaesgelhglttdekfte
gvyrveldtksywkalgispfheyaevvftandsghrhytiaallspysysttavvsnpq
n

SCOP Domain Coordinates for d1kgjb_:

Click to download the PDB-style file with coordinates for d1kgjb_.
(The format of our PDB-style files is described here.)

Timeline for d1kgjb_: