Lineage for d1kgic_ (1kgi C:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 223936Fold b.3: Prealbumin-like [49451] (6 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 224019Superfamily b.3.4: Transthyretin (prealbumin) [49472] (1 family) (S)
  5. 224020Family b.3.4.1: Transthyretin (prealbumin) [49473] (1 protein)
  6. 224021Protein Transthyretin (synonym: prealbumin) [49474] (3 species)
    sandwich; 8 strands in 2 sheets
  7. 224134Species Rat (Rattus norvegicus) [TaxId:10116] [49476] (4 PDB entries)
  8. 224137Domain d1kgic_: 1kgi C: [77390]

Details for d1kgic_

PDB Entry: 1kgi (more details), 1.8 Å

PDB Description: rat transthyretin (also called prealbumin) complex with 3,3',5,5'- tetraiodothyroacetic acid (t4ac)

SCOP Domain Sequences for d1kgic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kgic_ b.3.4.1 (C:) Transthyretin (synonym: prealbumin) {Rat (Rattus norvegicus)}
eskcplmvkvldavrgspavdvavkvfkktadgswepfasgktaesgelhglttdekfte
gvyrveldtksywkalgispfheyaevvftandsghrhytiaallspysysttavvsnpq
n

SCOP Domain Coordinates for d1kgic_:

Click to download the PDB-style file with coordinates for d1kgic_.
(The format of our PDB-style files is described here.)

Timeline for d1kgic_: